PDB entry 1gl0

View 1gl0 on RCSB PDB site
Description: structure of the complex between bovine alpha-chymotrypsin and pmp-d2v, an inhibitor from the insect locusta migratoria
Class: hydrolase/inhibitor
Keywords: hydrolase/inhibitor, complex (protease/inhibitor), hydrolase, serine protease, serine protease inhibitor
Deposited on 2001-08-22, released 2001-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.174
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gl0e_
  • Chain 'I':
    Compound: protease inhibitor lcmi I
    Species: LOCUSTA MIGRATORIA, synthetic [TaxId:7004]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80060
      • engineered mutation (28-29)
    Domains in SCOPe 2.07: d1gl0i_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gl0E (E:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl0E (E:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdamicag
    asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
    n
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1gl0I (I:)
    eekctpgqvkqqdcntctctptgvwgctlmgcqpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl0I (I:)
    kctpgqvkqqdcntctctptgvwgctlmgcqp