PDB entry 1gku

View 1gku on RCSB PDB site
Description: reverse gyrase from archaeoglobus fulgidus
Deposited on 2001-08-21, released 2002-02-11
The last revision prior to the SCOP 1.61 freeze date was dated 2002-02-11, with a file datestamp of 2002-02-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gkuB (B:)
    aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaslclfpedfllkefveffrkcvgeprai
    qkmwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetir
    kyaekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfif
    vddvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqll
    nfdigssritvrnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfr
    igivtatkkgdyekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtied
    idslspqmvkllaylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvrege
    vifpdlrtyiqgsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevd
    feklsreldesrdryrrrqefdlikpalfivesptkarqisrffgkpsvkvldgavvyei
    pmqkyvlmvtasighvvdlitnrgfhgvlvngrfvpvyasikrcrdcgyqftedrescpk
    cgsenvdnsrsriealrklahdaefvivgtdpdtegekiawdlknllsgcgavkraefhe
    vtrrailealeslrdvdenlvkaqvvrriedrwigfvlsqklwerfnnrnlsagraqtlv
    lgwiidrfqesrerrkiaivrdfdlvlehdeeefdltiklveereelrtplppyttetml
    sdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgqriakeylgddfvgrewge
    sgahecirptrpltrddvqrliqegvlvveglrwehfalydlifrrfmasqcrpfkvvvk
    kysiefdgktaeeerivraegrayelyravwvknelptgtfrvkaevksvpkvlpftqse
    iiqmmkergigrpstyativdrlfmrnyvvekygrmiptklgidvfrflvrryakfvsed
    rtrdlesrmdaiergeldylkaledmyaeiksid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkuB (B:)
    aaaaaaaaaaaaaaaaaaaslclfpedfllkefveffrkcvgepraiqkmwakrilrkes
    faataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgtenl
    igyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkaskn
    vdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssritvrn
    vedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfrigivtatkkgdye
    kfvegeidhligtahrgldlperirfavfvgcpsfrvtiedidslspqmvkllaylyrnv
    deierllpaverhidevreilkkvmgkerpqakdvvvregevifpdlrtyiqgsgrtsrl
    faggltkgasflleddsellsafieraklydiefksidevdfeklsreldesrdryrrrq
    efdlikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvtasighvvdl
    itnrgfhgvlvngrfvpvyasikdnsrsriealrklahdaefvivgtdpdtegekiawdl
    knllsgcgavkraefhevtrrailealeslrdvdenlvkaqvvrriedrwigfvlsqklw
    erfnnrnlsagraqtlvlgwiidrfqesrerrkiaivrdfdlvlehdeeefdltiklvee
    reelrtplppyttetmlsdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgqr
    iakeylgddfvgrewgesgahecirptrpltrddvqrliqegvlvveglrwehfalydli
    frrfmasqcrpfkvvvkkysiefdgktaeeerivraegrayelyravwvknelptgtfrv
    kaevksvpkvlpftqseiiqmmkergigrpstyativdrlfmrnyvvekygrmiptklgi
    dvfrflvrryakfvsedrtrdlesrmdaiergeldylkaledmyaeiksid