PDB entry 1gks

View 1gks on RCSB PDB site
Description: ectothiorhodospira halophila cytochrome c551 (reduced), nmr, 37 structures
Class: electron transport
Keywords: bacterial cytochrome c, halophilic purple phototrophic bacterium, electron transport
Deposited on 1996-07-16, released 1997-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c551
    Species: Halorhodospira halophila [TaxId:1053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gksa_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gksA (A:)
    dgesiyingtaptcsschdrgvagapelnapedwadrpssvdelvestlagkgampaydg
    radredlvkaieymlstl