PDB entry 1gkr

View 1gkr on RCSB PDB site
Description: l-hydantoinase (dihydropyrimidinase) from arthrobacter aurescens
Class: hydrolase
Keywords: hydrolase, hydantoinase, dihydropyrimidinase, cyclic amidase
Deposited on 2001-08-20, released 2002-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.224
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-ATP dependent l-selective hydantoinase
    Species: ARTHROBACTER AURESCENS [TaxId:43663]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81006 (0-End)
      • modified residue (146)
    Domains in SCOPe 2.07: d1gkra1, d1gkra2
  • Chain 'B':
    Compound: non-ATP dependent l-selective hydantoinase
    Species: ARTHROBACTER AURESCENS [TaxId:43663]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81006 (0-End)
      • modified residue (146)
    Domains in SCOPe 2.07: d1gkrb1, d1gkrb2
  • Chain 'C':
    Compound: non-ATP dependent l-selective hydantoinase
    Species: ARTHROBACTER AURESCENS [TaxId:43663]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81006 (0-End)
      • modified residue (146)
    Domains in SCOPe 2.07: d1gkrc1, d1gkrc2
  • Chain 'D':
    Compound: non-ATP dependent l-selective hydantoinase
    Species: ARTHROBACTER AURESCENS [TaxId:43663]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81006 (0-End)
      • modified residue (146)
    Domains in SCOPe 2.07: d1gkrd1, d1gkrd2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gkrA (A:)
    mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpgvvdeh
    vhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqagqrlkvd
    falygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeiaacgsvi
    vvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcrlivlhv
    snpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemnirlweq
    lenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgrlslerl
    vevmcekpaklfgiypqkgtlqvgsdadllildldidtkvdasqfrslhkyspfdgmpvt
    gapvltmvrgtvvaekgevlveqgfgqfvtrrnyeask
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkrA (A:)
    mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpgvvdeh
    vhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqagqrlkvd
    falygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeiaacgsvi
    vvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcrlivlhv
    snpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemnirlweq
    lenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgrlslerl
    vevmcekpaklfgiypqkgtlqvgsdadllildldidtkvdasqfrslhkyspfdgmpvt
    gapvltmvrgtvvaekgevlveqgfgqfvtr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gkrB (B:)
    mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpgvvdeh
    vhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqagqrlkvd
    falygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeiaacgsvi
    vvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcrlivlhv
    snpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemnirlweq
    lenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgrlslerl
    vevmcekpaklfgiypqkgtlqvgsdadllildldidtkvdasqfrslhkyspfdgmpvt
    gapvltmvrgtvvaekgevlveqgfgqfvtrrnyeask
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkrB (B:)
    mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpgvvdeh
    vhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqagqrlkvd
    falygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeiaacgsvi
    vvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcrlivlhv
    snpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemnirlweq
    lenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgrlslerl
    vevmcekpaklfgiypqkgtlqvgsdadllildldidtkvdasqfrslhkyspfdgmpvt
    gapvltmvrgtvvaekgevlveqgfgqfvtr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gkrC (C:)
    mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpgvvdeh
    vhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqagqrlkvd
    falygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeiaacgsvi
    vvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcrlivlhv
    snpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemnirlweq
    lenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgrlslerl
    vevmcekpaklfgiypqkgtlqvgsdadllildldidtkvdasqfrslhkyspfdgmpvt
    gapvltmvrgtvvaekgevlveqgfgqfvtrrnyeask
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkrC (C:)
    mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpgvvdeh
    vhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqagqrlkvd
    falygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeiaacgsvi
    vvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcrlivlhv
    snpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemnirlweq
    lenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgrlslerl
    vevmcekpaklfgiypqkgtlqvgsdadllildldidtkvdasqfrslhkyspfdgmpvt
    gapvltmvrgtvvaekgevlveqgfgqfvtr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gkrD (D:)
    mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpgvvdeh
    vhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqagqrlkvd
    falygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeiaacgsvi
    vvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcrlivlhv
    snpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemnirlweq
    lenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgrlslerl
    vevmcekpaklfgiypqkgtlqvgsdadllildldidtkvdasqfrslhkyspfdgmpvt
    gapvltmvrgtvvaekgevlveqgfgqfvtrrnyeask
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkrD (D:)
    mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpgvvdeh
    vhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqagqrlkvd
    falygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeiaacgsvi
    vvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcrlivlhv
    snpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemnirlweq
    lenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgrlslerl
    vevmcekpaklfgiypqkgtlqvgsdadllildldidtkvdasqfrslhkyspfdgmpvt
    gapvltmvrgtvvaekgevlveqgfgqfvtr