PDB entry 1gkq

View 1gkq on RCSB PDB site
Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group p212121
Deposited on 2001-08-20, released 2002-06-27
The last revision prior to the SCOP 1.71 freeze date was dated 2002-06-27, with a file datestamp of 2002-06-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.1876
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkqA (A:)
    pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgfidphvh
    iylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskaegnsycdy
    tfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlakelgvivt
    ahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgatgyvvhls
    ckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdkrnqkvlw
    dalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvsrgrldih
    rfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfe
    idgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkqB (B:)
    pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgfidphvh
    iylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskaegnsycdy
    tfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlakelgvivt
    ahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgatgyvvhls
    ckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdkrnqkvlw
    dalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvsrgrldih
    rfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfe
    idgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkqC (C:)
    pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgfidphvh
    iylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskaegnsycdy
    tfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlakelgvivt
    ahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgatgyvvhls
    ckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdkrnqkvlw
    dalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvsrgrldih
    rfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfe
    idgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkqD (D:)
    pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgfidphvh
    iylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskaegnsycdy
    tfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlakelgvivt
    ahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgatgyvvhls
    ckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdkrnqkvlw
    dalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvsrgrldih
    rfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfe
    idgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf