PDB entry 1gkp

View 1gkp on RCSB PDB site
Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group c2221
Class: hydrolase
Keywords: hydrolase, hydantoinase, dihydropyrimidinase, cyclic amidase
Deposited on 2001-08-20, released 2002-06-27
The last revision prior to the SCOP 1.73 freeze date was dated 2002-06-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.15352
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydantoinase
    Species: Thermus sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SIE9 (0-457)
      • modified residue (148)
    Domains in SCOP 1.73: d1gkpa1, d1gkpa2
  • Chain 'B':
    Compound: hydantoinase
    Species: Thermus sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SIE9 (0-457)
      • modified residue (148)
    Domains in SCOP 1.73: d1gkpb1, d1gkpb2
  • Chain 'C':
    Compound: hydantoinase
    Species: Thermus sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SIE9 (0-457)
      • modified residue (148)
    Domains in SCOP 1.73: d1gkpc1, d1gkpc2
  • Chain 'D':
    Compound: hydantoinase
    Species: Thermus sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SIE9 (0-457)
      • modified residue (148)
    Domains in SCOP 1.73: d1gkpd1, d1gkpd2
  • Chain 'E':
    Compound: hydantoinase
    Species: Thermus sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SIE9 (0-457)
      • modified residue (148)
    Domains in SCOP 1.73: d1gkpe1, d1gkpe2
  • Chain 'F':
    Compound: hydantoinase
    Species: Thermus sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SIE9 (0-457)
      • modified residue (148)
    Domains in SCOP 1.73: d1gkpf1, d1gkpf2
  • Heterogens: ZN, SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkpA (A:)
    pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgfidphvh
    iylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskaegnsycdy
    tfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlakelgvivt
    ahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgatgyvvhls
    ckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdkrnqkvlw
    dalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvsrgrldih
    rfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfe
    idgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkpB (B:)
    pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgfidphvh
    iylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskaegnsycdy
    tfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlakelgvivt
    ahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgatgyvvhls
    ckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdkrnqkvlw
    dalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvsrgrldih
    rfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfe
    idgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkpC (C:)
    pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgfidphvh
    iylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskaegnsycdy
    tfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlakelgvivt
    ahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgatgyvvhls
    ckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdkrnqkvlw
    dalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvsrgrldih
    rfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfe
    idgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkpD (D:)
    pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgfidphvh
    iylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskaegnsycdy
    tfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlakelgvivt
    ahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgatgyvvhls
    ckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdkrnqkvlw
    dalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvsrgrldih
    rfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfe
    idgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkpE (E:)
    pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgfidphvh
    iylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskaegnsycdy
    tfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlakelgvivt
    ahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgatgyvvhls
    ckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdkrnqkvlw
    dalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvsrgrldih
    rfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfe
    idgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkpF (F:)
    pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgfidphvh
    iylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskaegnsycdy
    tfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlakelgvivt
    ahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgatgyvvhls
    ckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdkrnqkvlw
    dalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvsrgrldih
    rfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfe
    idgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf