PDB entry 1gkn

View 1gkn on RCSB PDB site
Description: structure determination and rational mutagenesis reveal binding surface of immune adherence receptor, cr1 (cd35)
Class: complement
Keywords: complement, module, scr, structure
Deposited on 2001-08-16, released 2002-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement receptor type 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GKN (0-3)
      • engineered mutation (21)
      • engineered mutation (90)
    • Uniprot P17927 (4-127)
    Domains in SCOPe 2.08: d1gkna1, d1gkna2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gknA (A:)
eaeahcqapdhflfaklktqttasdfpigtslkyecrpeyygrpfsitcldnlvwsspkd
vckrkscktppdpvngmvhvitdiqvgsrityscttghrlighssaecilsgntahwstk
ppicqrip