PDB entry 1gkk

View 1gkk on RCSB PDB site
Description: feruloyl esterase domain of xyny from clostridium thermocellum
Class: hydrolase
Keywords: hydrolase, ferulic acid, esterase family 1
Deposited on 2001-08-15, released 2001-12-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.155
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GKK (289-296)
      • conflict (228-229)
    • Uniprot P51584 (Start-288)
    Domains in SCOPe 2.05: d1gkka_
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GKK (289-296)
      • conflict (228-229)
    • Uniprot P51584 (Start-288)
    Domains in SCOPe 2.05: d1gkkb_
  • Heterogens: CD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gkkA (A:)
    masdkfpvaenpsssfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylp
    ygydpnkkynifylmhgggenentifsndvklqnildhaimngeleplivvtptfnggnc
    taqnfyqefrqnvipfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncl
    dyvayfmplsgdywygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqi
    eamkalphfdytsdfskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkkA (A:)
    sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
    mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
    pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
    ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
    fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gkkB (B:)
    masdkfpvaenpsssfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylp
    ygydpnkkynifylmhgggenentifsndvklqnildhaimngeleplivvtptfnggnc
    taqnfyqefrqnvipfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncl
    dyvayfmplsgdywygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqi
    eamkalphfdytsdfskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gkkB (B:)
    sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
    mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
    pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
    ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
    fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh