PDB entry 1gkj

View 1gkj on RCSB PDB site
Description: histidine ammonia-lyase (hal) mutant y280f from pseudomonas putida
Class: lyase
Keywords: lyase, ammonia-lyase, histidine degradation
Deposited on 2001-08-15, released 2002-04-05
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine ammonia-lyase
    Species: PSEUDOMONAS PUTIDA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21310 (0-508)
      • engineered mutation (272)
      • engineered mutation (279)
    Domains in SCOP 1.75: d1gkja_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkjA (A:)
    teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
    llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
    alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
    epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
    heargqrgqidtaacfrdllgdssevslshknadkvqdpfslrcqpqvmgacltqlrqaa
    evlgieanavsdnplvfaaegdvisggnfhaepvamaadnlalaiaeigslserrislmm
    dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
    paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
    fapdiekavellakgsltgllpagvlpsl