PDB entry 1gkg

View 1gkg on RCSB PDB site
Description: structure determination and rational mutagenesis reveal binding surface of immune adherence receptor, cr1 (cd35)
Deposited on 2001-08-14, released 2002-04-18
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-18, with a file datestamp of 2002-04-18.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gkgA (A:)
eaeakscktppdpvngmvhvitdiqvgsrityscttghrlighssaecilsgntahwstk
ppicqripcglpptiangdfistnrenfhygsvvtyrcnlgsrgrkvfelvgepsiycts
nddqvgiwsgpapqci