PDB entry 1gkg

View 1gkg on RCSB PDB site
Description: structure determination and rational mutagenesis reveal binding surface of immune adherence receptor, cr1 (cd35)
Class: complement
Keywords: complement, module, scr, structure, sushi
Deposited on 2001-08-14, released 2002-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: complement receptor type 1
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 1GKG (0-3)
    • engineered mutation (30)
  • Uniprot P17927 (4-135)
  Domains in SCOPe 2.08: d1gkga1, d1gkga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gkgA (A:)
  eaeakscktppdpvngmvhvitdiqvgsrityscttghrlighssaecilsgntahwstk
  ppicqripcglpptiangdfistnrenfhygsvvtyrcnlgsrgrkvfelvgepsiycts
  nddqvgiwsgpapqci