PDB entry 1gke

View 1gke on RCSB PDB site
Description: rat transthyretin
Class: transport protein
Keywords: transport protein, transport of thyroid hormones, rat transthyretin, prealbumin
Deposited on 1997-05-13, released 1998-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gkea_
  • Chain 'B':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gkeb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gkec_
  • Chain 'D':
    Compound: Transthyretin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gked_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkeA (A:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkeB (B:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkeC (C:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkeD (D:)
    skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
    vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn