PDB entry 1gka

View 1gka on RCSB PDB site
Description: the molecular basis of the coloration mechanism in lobster shell. beta-crustacyanin at 3.2 a resolution
Class: lipocalin
Keywords: lipocalin, crustacyanin, lobster, astaxanthin, bathochromic, coloration
Deposited on 2001-08-10, released 2002-08-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.23 Å
R-factor: 0.213
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: crustacyanin a1 subunit
    Species: Homarus gammarus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gkaa_
  • Chain 'B':
    Compound: crustacyanin a2 subunit
    Species: Homarus gammarus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gkab_
  • Heterogens: AXT, D12, TRS, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkaA (A:)
    kipnfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
    qfvikstgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
    idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gkaB (B:)
    dgipsfvtagkcasvanqdnfdlrryagrwyqthiienayqpvtrcihsnyeystndygf
    kvttagfnpndeylkidfkvyptkefpaahmlidapsvfaapyevietdyetyscvysci
    ttdnyksefafvfsrtpqtsgpavektaavfnkngvefskfvpvshtaecvyra