PDB entry 1gk8

View 1gk8 on RCSB PDB site
Description: rubisco from chlamydomonas reinhardtii
Deposited on 2001-08-09, released 2001-10-24
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-24, with a file datestamp of 2001-10-24.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.149
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk8A (A:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk8C (C:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk8E (E:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk8G (G:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk8I (I:)
    mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
    svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
    lvqrp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk8K (K:)
    mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
    svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
    lvqrp
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk8M (M:)
    mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
    svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
    lvqrp
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk8O (O:)
    mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
    svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
    lvqrp