PDB entry 1gk7

View 1gk7 on RCSB PDB site
Description: human vimentin coil 1a fragment (1a)
Class: vimentin
Keywords: vimentin, intermediate filament, heptad repeat
Deposited on 2001-08-08, released 2002-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vimentin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GK7 (0-1)
    • Uniprot P08670 (2-38)
    Domains in SCOPe 2.08: d1gk7a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk7A (A:)
    gsnekvelqelndrfanyidkvrfleqqnkillaeleql