PDB entry 1gk2

View 1gk2 on RCSB PDB site
Description: histidine ammonia-lyase (hal) mutant f329g from pseudomonas putida
Class: lyase
Keywords: lyase, ammonia-lyase, histidine degradation
Deposited on 2001-08-07, released 2002-02-21
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine ammonia-lyase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21310 (0-508)
      • engineered mutation (272)
      • engineered mutation (328)
    Domains in SCOP 1.73: d1gk2a_
  • Chain 'B':
    Compound: histidine ammonia-lyase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21310 (0-508)
      • engineered mutation (272)
      • engineered mutation (328)
    Domains in SCOP 1.73: d1gk2b_
  • Chain 'C':
    Compound: histidine ammonia-lyase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21310 (0-508)
      • engineered mutation (272)
      • engineered mutation (328)
    Domains in SCOP 1.73: d1gk2c_
  • Chain 'D':
    Compound: histidine ammonia-lyase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21310 (0-508)
      • engineered mutation (272)
      • engineered mutation (328)
    Domains in SCOP 1.73: d1gk2d_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk2A (A:)
    teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
    llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
    alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
    epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
    heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
    evlgieanavsdnplvfaaegdvisggnghaepvamaadnlalaiaeigslserrislmm
    dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
    paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
    fapdiekavellakgsltgllpagvlpsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk2B (B:)
    teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
    llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
    alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
    epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
    heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
    evlgieanavsdnplvfaaegdvisggnghaepvamaadnlalaiaeigslserrislmm
    dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
    paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
    fapdiekavellakgsltgllpagvlpsl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk2C (C:)
    teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
    llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
    alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
    epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
    heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
    evlgieanavsdnplvfaaegdvisggnghaepvamaadnlalaiaeigslserrislmm
    dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
    paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
    fapdiekavellakgsltgllpagvlpsl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gk2D (D:)
    teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
    llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
    alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
    epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
    heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
    evlgieanavsdnplvfaaegdvisggnghaepvamaadnlalaiaeigslserrislmm
    dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
    paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
    fapdiekavellakgsltgllpagvlpsl