PDB entry 1gjz

View 1gjz on RCSB PDB site
Description: solution structure of a dimeric n-terminal fragment of human ubiquitin
Class: ubiquitin
Keywords: ubiquitin, dimer, protein dissection
Deposited on 2001-08-06, released 2001-12-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GJZ (0-1)
    • Uniprot P02248 (2-52)
    Domains in SCOPe 2.02: d1gjza_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GJZ (0-1)
    • Uniprot P02248 (2-52)
    Domains in SCOPe 2.02: d1gjzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gjzA (A:)
    gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gjzB (B:)
    gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqle