PDB entry 1gjt

View 1gjt on RCSB PDB site
Description: solution structure of the albumin binding domain of streptococcal protein g
Deposited on 2001-08-02, released 2001-08-09
The last revision prior to the SCOP 1.67 freeze date was dated 2001-08-09, with a file datestamp of 2001-08-09.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1gjta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gjtA (A:)
    mkaifvlnaqhdeavdanslaeakvlanreldkygvsdyyknlinnaktvegvkalidei
    laalp