PDB entry 1gjt

View 1gjt on RCSB PDB site
Description: Solution structure of the Albumin binding domain of Streptococcal Protein G
Class: immunoglobulin-binding protein
Keywords: immunoglobulin-binding protein, bacterial surface protein, albumin binding, protein g
Deposited on 2001-08-02, released 2001-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GJT (0-18)
    • Uniprot P19909 (19-64)
    Domains in SCOPe 2.08: d1gjta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gjtA (A:)
    mkaifvlnaqhdeavdanslaeakvlanreldkygvsdyyknlinnaktvegvkalidei
    laalp