PDB entry 1gjq

View 1gjq on RCSB PDB site
Description: pseudomonas aeruginosa cd1 nitrite reductase reduced cyanide complex
Deposited on 2001-08-01, released 2002-08-01
The last revision prior to the SCOP 1.69 freeze date was dated 2002-08-01, with a file datestamp of 2002-08-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gjqA (A:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gjqA (A:)
    dmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkp
    ltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmp
    emreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavh
    isrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytia
    gaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketg
    kvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalv
    dvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqggg
    slfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvv
    qpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdv
    y
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gjqB (B:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gjqB (B:)
    kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
    pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpem
    reswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhis
    rmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiaga
    ywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkv
    llvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdv
    gktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggsl
    fikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqp
    eynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy