PDB entry 1gjp

View 1gjp on RCSB PDB site
Description: schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with 4-oxosebacic acid
Deposited on 2001-08-01, released 2001-08-02
The last revision prior to the SCOP 1.65 freeze date was dated 2002-05-16, with a file datestamp of 2002-05-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.265
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1gjpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gjpA (A:)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
    eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
    grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
    ekgvvdlktiafeshqgflragarliitylapefldwlde