PDB entry 1gjn

View 1gjn on RCSB PDB site
Description: hydrogen peroxide derived myoglobin compound II at ph 5.2
Class: oxygen transport
Keywords: oxygen transport, reaction intermediate, haem, heme, oxygen activation, peroxidase, monooxygenase, ferryl, hydroxy radical
Deposited on 2001-07-27, released 2002-03-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.178
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gjna_
  • Heterogens: HEM, OH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gjnA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg