PDB entry 1gjn

View 1gjn on RCSB PDB site
Description: hydrogen peroxide derived myoglobin compound ii at ph 5.2
Deposited on 2001-07-27, released 2002-03-01
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-01, with a file datestamp of 2002-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.178
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gjna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gjnA (A:)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg