PDB entry 1gjm

View 1gjm on RCSB PDB site
Description: covalent attachment of an electroactive sulphydryl reagent in the active site of cytochrome p450cam
Class: oxidoreductase(oxygenase)
Keywords: oxidoreductase(oxygenase)
Deposited on 2001-07-26, released 2001-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-413)
      • engineered mutation (333)
    Domains in SCOPe 2.06: d1gjma_
  • Heterogens: HEM, FEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gjmA (A:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gjmA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav