PDB entry 1gjj

View 1gjj on RCSB PDB site
Description: n-terminal constant region of the nuclear envelope protein lap2
Class: membrane protein
Keywords: inner nuclear membrane protein, lamin-associated polypeptide, lem domain, multidimensional nmr dipolar couplings
Deposited on 2001-06-25, released 2003-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: 0.1
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lap2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gjja1, d1gjja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gjjA (A:)
    mpefledpsvltkdklkselvannvtlpageqrkdvyvqlylqhltarnrpplpagtnsk
    gppdfssdeereptpvlgsgaaaagrsraavgrkatkktdkprqedkddldvteltnedl
    ldqlvkygvnpgpivgttrklyekkllklreqgtesrsstplptisss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gjjA (A:)
    mpefledpsvltkdklkselvannvtlpageqrkdvyvqlylqhltarnrdvteltnedl
    ldqlvkygvnpgpivgttrklyekkllklreqg