PDB entry 1gj6

View 1gj6 on RCSB PDB site
Description: engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Class: hydrolase
Keywords: selectivity at S1, H2O displacement, uPA, tPA, Ser190/Ala190 protease, structure-based drug design
Deposited on 2001-04-27, released 2002-04-27
The last revision prior to the SCOP 1.75 freeze date was dated 2002-04-27, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.187
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gj6a_
  • Heterogens: CA, 132, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gj6A (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn