SCOPe 2.01: Structural Classification of Proteins

PDB entry 1gix

View 1gix on RCSB PDB site
Description: Crystal structure of the ribosome at 5.5 A resolution. This file, 1GIX, contains the 30S ribosome subunit, three tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1GIY
Class: ribosome
Keywords: ribosome assembly, protein synthesis, life, RIBOSOME
Deposited on 2001-03-30, released 2001-05-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 5.5 Å
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

Chain '1':
Compound: a- and p-site messenger RNA codons
Chain 'A':
Compound: 30s 16s ribosomal RNA
Species: Thermus thermophilus [TaxId:274]
Chain 'B':
Compound: tRNA(phe)
Species: synthetic, synthetic
Chain 'C':
Compound: tRNA(phe)
Species: synthetic, synthetic
Chain 'D':
Compound: tRNA(phe)
Species: synthetic, synthetic
Chain 'E':
Compound: 30S ribosomal protein S2
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P80371
Domains in SCOPe 2.01: d1gixe_
Chain 'F':
Compound: 30S ribosomal protein S3
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P62663
Domains in SCOPe 2.01: d1gixf_
Chain 'G':
Compound: 30S ribosomal protein S4
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P80373 (Start-208)
Domains in SCOPe 2.01: d1gixg_
Chain 'H':
Compound: 30S ribosomal protein S5
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHQ5
Domains in SCOPe 2.01: d1gixh_
Chain 'I':
Compound: 30S ribosomal protein S6
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLP8 (0-100)
Domains in SCOPe 2.01: d1gixi_
Chain 'J':
Compound: 30S ribosomal protein S7
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P17291 (Start-155)
Domains in SCOPe 2.01: d1gixj_
Chain 'K':
Compound: 30S ribosomal protein S8
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHQ2 (0-137)
Domains in SCOPe 2.01: d1gixk_
Chain 'L':
Compound: 30S ribosomal protein S9
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P80374 (Start-127)
Domains in SCOPe 2.01: d1gixl_
Chain 'M':
Compound: 30S ribosomal protein S10
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHN7
Domains in SCOPe 2.01: d1gixm_
Chain 'N':
Compound: 30S ribosomal protein S11
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P80376 (Start-128)
Domains in SCOPe 2.01: d1gixn_
Chain 'O':
Compound: 30S ribosomal protein S12
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHN3
Domains in SCOPe 2.01: d1gixo_
Chain 'P':
Compound: 30S ribosomal protein S13
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P80377 (Start-125)
Domains in SCOPe 2.01: d1gixp_
Chain 'Q':
Compound: 30S ribosomal protein S14
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SHQ1 (Start-60)
Domains in SCOPe 2.01: d1gixq_
Chain 'R':
Compound: 30S ribosomal protein S15
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SJ76 (Start-88)
Domains in SCOPe 2.01: d1gixr_
Chain 'S':
Compound: 30S ribosomal protein S16
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- GB CAC21226 (0-End)
Domains in SCOPe 2.01: d1gixs_
Chain 'T':
Compound: 30S ribosomal protein S17
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- PDB 1GIX (Start-104)
Domains in SCOPe 2.01: d1gixt_
Chain 'U':
Compound: 30S ribosomal protein S18
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- GB AAF27297 (Start-87)
Domains in SCOPe 2.01: d1gixu_
Chain 'V':
Compound: 30S ribosomal protein S19
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P80381
Domains in SCOPe 2.01: d1gixv_
Chain 'W':
Compound: 30S ribosomal protein S20
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- GB CAC15067 (Start-105)
Domains in SCOPe 2.01: d1gixw_
Chain 'X':
Compound: 30S ribosomal protein Thx
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P32193 (0-End)
Domains in SCOPe 2.01: d1gixx_

PDB Chain Sequences:

Chain '1':
No sequence available.
Chain 'A':
No sequence available.
Chain 'B':
No sequence available.
Chain 'C':
No sequence available.
Chain 'D':
No sequence available.

Chain 'E':
Sequence, based on SEQRES records: (download)

>1gixE (E:)
mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfied
lamrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelea
lfaspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearkl
fipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
eaeatetpegesevea