PDB entry 1giu

View 1giu on RCSB PDB site
Description: a trichosanthin(tcs) mutant(e85r) complex structure with adenine
Class: hydrolase
Keywords: protein-sub complex, trichosanthin, tcs, hydrolase
Deposited on 2001-03-15, released 2003-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome-inactivating protein alpha-trichosanthin
    Species: Trichosanthes kirilowii [TaxId:3677]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09989 (0-246)
      • engineered (84)
    Domains in SCOPe 2.08: d1giua_
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1giuA (A:)
dvsfrlsgatsssygvfisnlrkalpnerklydipllrsslpgsqryalihltnyadeti
svaidvtnvyimgyragdtsyffnrasateaakyvfkdamrkvtlpysgnyerlqtaagk
ireniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigkrvdktfl
pslaiislenswsalskqiqiastnngqfespvvlinaqnqrvtitnvdagvvtsniall
lnrnnma