PDB entry 1gio

View 1gio on RCSB PDB site
Description: nmr solution structure of bovine angiogenin, 10 structures
Class: hydrolase angiogenesis
Keywords: endoribonuclease, hydrolase angiogenesis
Deposited on 1996-04-12, released 1996-12-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1gioa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gioA (A:)
    aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced
    rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf
    itprh