PDB entry 1gio

View 1gio on RCSB PDB site
Description: nmr solution structure of bovine angiogenin, 10 structures
Deposited on 1996-04-12, released 1996-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1gio__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gio_ (-)
    aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced
    rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf
    itprh