PDB entry 1gil

View 1gil on RCSB PDB site
Description: structure of active conformations of gia1 and the mechanism of GTP hydrolysis
Class: GTP-binding protein
Keywords: GTP-binding protein
Deposited on 1995-01-02, released 1995-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: g protein gi alpha 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10824
      • conflict (202)
    Domains in SCOPe 2.08: d1gila1, d1gila2
  • Heterogens: MG, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gilA (A:)
    gctlsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagy
    seeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmta
    elagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt
    tgivethftfkdlhfkmfdvgglrserkkwihcfegvtaiifcvalsdydlvlaedeemn
    rmhesmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaa
    yiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gilA (A:)
    vkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlki
    dfgdaaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlndsaa
    yylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvgglrserkkwih
    cfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdl
    feekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvq
    fvfdavtdvi