PDB entry 1gik

View 1gik on RCSB PDB site
Description: pokeweed antiviral protein from seeds
Class: hydrolase
Keywords: alpha+beta, hydrolase
Deposited on 2001-02-07, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antiviral protein s
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gika_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gikA (A:)
intitfdagnatinkyatfmeslrneakdpslkcygipmlpntnstikyllvklqgaslk
titlmlrrnnlyvmgysdpydnkcryhifndikgteysdventlcpssnprvakpinyng
lyptlekkagvtsrnevqlgiqilssdigkisgqgsftekieakfllvaiqmvseaarfk
yienqvktnfnrdfspndkvldleenwgkistaihnskngalpkplelknadgtkwivlr
vdeikpdvgllnyvngtcqat