PDB entry 1gij

View 1gij on RCSB PDB site
Description: human cyclin dependent kinase 2 complexed with the cdk4 inhibitor
Deposited on 2001-02-06, released 2002-02-06
The last revision prior to the SCOP 1.65 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1gija_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gijA (A:)
    menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
    pnivklldvihtenklylvfehvhqdlktfmdasaltgiplpliksylfqllqglafchs
    hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
    stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
    pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gijA (A:)
    menfqkvekigegtygvvykarnkltgevvalkkiraireisllkelnhpnivklldvih
    tenklylvfehvhqdlktfmdasaltgiplpliksylfqllqglafchshrvlhrdlkpq
    nllintegaikladfglavtlwyrapeillgckyystavdiwslgcifaemvtrralfpg
    dseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwarqdfskvvppldedgrsllsq
    mlhydpnkrisakaalahpffqdvtkpvphlrl