PDB entry 1gig

View 1gig on RCSB PDB site
Description: refined three-dimensional structure of the fab fragment of a murine igg1, lambda antibody
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-01-20, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa hc19 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAD00000 (0-220)
      • conflict (2)
      • conflict (4)
      • conflict (27)
      • conflict (29)
      • conflict (31)
      • conflict (62)
      • conflict (68)
      • conflict (82)
      • conflict (91)
      • insertion (97-99)
      • conflict (101-102)
      • insertion (104-109)
      • conflict (116)
      • conflict (121)
      • conflict (134)
    Domains in SCOPe 2.07: d1gigh1, d1gigh2
  • Chain 'L':
    Compound: igg1-kappa hc19 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAA39089 (0-209)
    Domains in SCOPe 2.07: d1gigl1, d1gigl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gigH (H:)
    qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
    salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gigL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtveksls