PDB entry 1gif

View 1gif on RCSB PDB site
Description: human glycosylation-inhibiting factor
Class: cytokine
Keywords: macrophage, inflammatory response, cytokine
Deposited on 1996-02-27, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosylation-inhibiting factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gifa_
  • Chain 'B':
    Compound: glycosylation-inhibiting factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gifb_
  • Chain 'C':
    Compound: glycosylation-inhibiting factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gifc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gifA (A:)
    mpmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
    slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gifB (B:)
    mpmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
    slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gifC (C:)
    mpmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
    slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa