PDB entry 1gi9

View 1gi9 on RCSB PDB site
Description: a novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Class: BLOOD CLOTTING, hydrolase
Keywords: three-centered, very short hydrogen bond, oxyanion hole water, shift of pKa of His57, structure-based drug design, specificity, urokinase, trypsin, thrombin, Zn+2-mediated inhibition
Deposited on 2001-01-22, released 2002-01-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gi9.1
  • Chain 'B':
    Compound: urokinase-type plasminogen activator
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-244)
      • conflict (143)
    Domains in SCOP 1.75: d1gi9.1
  • Heterogens: 123, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gi9A (A:)
    kpssppeelkfqcgqktlrprfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gi9A (A:)
    lkfqcgqkt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gi9B (B:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    clpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irsht