PDB entry 1gi9

View 1gi9 on RCSB PDB site
Description: a novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Class: BLOOD CLOTTING, hydrolase
Keywords: three-centered, very short hydrogen bond, oxyanion hole water, shift of pKa of His57, structure-based drug design, specificity, urokinase, trypsin, thrombin, Zn+2-mediated inhibition, BLOOD CLOTTING, hydrolase
Deposited on 2001-01-22, released 2002-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gi9.1
  • Chain 'B':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-244)
      • conflict (143)
    Domains in SCOPe 2.08: d1gi9.1
  • Heterogens: 123, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gi9A (A:)
    kpssppeelkfqcgqktlrprfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gi9A (A:)
    lkfqcgqkt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gi9B (B:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    clpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irsht