PDB entry 1gi2

View 1gi2 on RCSB PDB site
Description: a novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Deposited on 2001-01-22, released 2002-01-22
The last revision prior to the SCOP 1.67 freeze date was dated 2002-02-22, with a file datestamp of 2002-02-22.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.184
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1gi2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gi2A (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn