PDB entry 1ghu

View 1ghu on RCSB PDB site
Description: NMR solution structure of growth factor receptor-bound protein 2 (GRB2) SH2 domain, 24 structures
Class: src homology 2 domain
Keywords: src homology 2 domain, grb2, sh2
Deposited on 1996-08-05, released 1997-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: grb2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ghua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ghuA (A:)
    gswffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
    yflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqpefivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ghuA (A:)
    gswffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
    yflwvvkfnslnelvdyhrstsvsrnqqiflrdie