PDB entry 1ghq

View 1ghq on RCSB PDB site
Description: cr2-c3d complex structure
Class: Immune system/viral protein receptor
Keywords: CR2, C3D, Immune system/viral protein receptor COMPLEX
Deposited on 2001-01-11, released 2001-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01024 (2-End)
      • cloning artifact (0-1)
      • engineered (16)
      • insertion (294)
    Domains in SCOPe 2.06: d1ghqa1, d1ghqa2
  • Chain 'B':
    Compound: cr2/cd121/c3d/epstein-barr virus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20023 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1ghqb1, d1ghqb2, d1ghqb3
  • Chain 'C':
    Compound: cr2/cd121/c3d/epstein-barr virus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20023 (1-133)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1ghqc1, d1ghqc2, d1ghqc3
  • Heterogens: NDG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ghqA (A:)
    mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
    tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
    pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
    dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
    syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel
    nldvslql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ghqA (A:)
    mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
    tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
    pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
    dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
    syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel
    nldvslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ghqB (B:)
    aiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
    pkceyfnkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwg
    ptrlptcvsvfple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ghqB (B:)
    aiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
    pkceyfnkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwg
    ptrlptcvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghqC (C:)
    aiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
    pkceyfnkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwg
    ptrlptcvsvfple