PDB entry 1ghq

View 1ghq on RCSB PDB site
Description: cr2-c3d complex structure
Deposited on 2001-01-11, released 2001-06-06
The last revision prior to the SCOP 1.67 freeze date was dated 2001-06-06, with a file datestamp of 2001-06-06.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ghqA (A:)
    mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
    tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
    pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
    dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
    syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel
    nldvslql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ghqA (A:)
    mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
    tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
    pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
    dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
    syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel
    nldvslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ghqB (B:)
    aiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
    pkceyfnkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwg
    ptrlptcvsvfple
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ghqB (B:)
    aiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
    pkceyfnkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwg
    ptrlptcvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghqC (C:)
    aiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
    pkceyfnkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwg
    ptrlptcvsvfple