PDB entry 1gho

View 1gho on RCSB PDB site
Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)
Deposited on 2000-06-07, released 2001-02-21
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-21, with a file datestamp of 2001-02-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghoI (I:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghoJ (J:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghoK (K:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghoL (L:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghoM (M:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghoN (N:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghoO (O:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghoP (P:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k