PDB entry 1ghl

View 1ghl on RCSB PDB site
Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1993-05-04, released 1993-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheasant egg white lysozyme
    Species: Phasianus colchicus [TaxId:9054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ghla_
  • Chain 'B':
    Compound: pheasant egg white lysozyme
    Species: Phasianus colchicus [TaxId:9054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ghlb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghlA (A:)
    gkvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqin
    srwwcndgrtpgsknlchipcsallssditasvncakkivsdgngmnawvawrkhckgtd
    vnvwirgcrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghlB (B:)
    gkvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqin
    srwwcndgrtpgsknlchipcsallssditasvncakkivsdgngmnawvawrkhckgtd
    vnvwirgcrl