PDB entry 1ghi

View 1ghi on RCSB PDB site
Description: structure of beta-lactamase glu166asp:asn170gln mutant
Class: hydrolase
Keywords: hydrolase, antibiotic resistance, beta-lactam hydrolysis
Deposited on 2000-12-18, released 2001-04-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.153
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: BLAZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00807 (1-257)
      • engineered (133)
      • engineered (137)
    Domains in SCOPe 2.05: d1ghia_
  • Heterogens: CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ghiA (A:)
    mkelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynkln
    kkvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrl
    kelgdkvtnpvrydielqyyspkskkdtstpaafgktlnkliangklskenkkflldlml
    nnksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksd
    kpndklisetaksvmkef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ghiA (A:)
    kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
    kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
    elgdkvtnpvrydielqyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
    nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
    pndklisetaksvmkef