PDB entry 1ghh

View 1ghh on RCSB PDB site
Description: solution structure of dini
Class: protein binding
Keywords: bicelle, DinI, dipolar coupling, liquid crystal, NMR, Pf1, RecA, PROTEIN BINDING
Deposited on 2000-12-19, released 2001-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-damage-inducible protein I
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABR1 (0-80)
  Domains in SCOPe 2.06: d1ghha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ghhA (A:)
  mrievtiaktsplpagaidalagelsrriqyafpdneghvsvryaaannlsvigatkedk
  qriseilqetwesaddwfvse