PDB entry 1ghh

View 1ghh on RCSB PDB site
Description: solution structure of dini
Class: protein binding
Keywords: bicelle, DinI, dipolar coupling, liquid crystal, NMR, Pf1, RecA, PROTEIN BINDING
Deposited on 2000-12-19, released 2001-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-damage-inducible protein I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ghha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghhA (A:)
    mrievtiaktsplpagaidalagelsrriqyafpdneghvsvryaaannlsvigatkedk
    qriseilqetwesaddwfvse