PDB entry 1ghf

View 1ghf on RCSB PDB site
Description:
Deposited on 1995-11-30, released 1996-12-23
The last revision prior to the SCOP 1.65 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1ghfh1, d1ghfh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1ghfl1, d1ghfl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghfH (H:)
    vqlqqsgpelkkpgetvkiscklwytftdygmnwvkqapgkglkwmgwiqtnteeptyga
    efkgrfafsletsaftaykqinnlknedmatyfcarveagfdywaqgttltvssakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpssprpsetvtcnvahpasstkvdkkii
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghfL (L:)
    diqmtqttsslsaslgdrvtiscresqdisnslnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgtgtdysltisnleqedfatyfcqqgntlpytfgggtkleikradaaqtvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr