PDB entry 1ghf

View 1ghf on RCSB PDB site
Description: anti-anti-idiotype gh1002 fab fragment
Class: antibody fab fragment
Keywords: antibody fab fragment
Deposited on 1995-11-30, released 1996-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-anti-idiotype gh1002 fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GHF (0-211)
    Domains in SCOPe 2.07: d1ghfh1, d1ghfh2
  • Chain 'L':
    Compound: anti-anti-idiotype gh1002 fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GHF (0-210)
    Domains in SCOPe 2.07: d1ghfl1, d1ghfl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghfH (H:)
    vqlqqsgpelkkpgetvkiscklwytftdygmnwvkqapgkglkwmgwiqtnteeptyga
    efkgrfafsletsaftaykqinnlknedmatyfcarveagfdywaqgttltvssakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpssprpsetvtcnvahpasstkvdkkii
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghfL (L:)
    diqmtqttsslsaslgdrvtiscresqdisnslnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgtgtdysltisnleqedfatyfcqqgntlpytfgggtkleikradaaqtvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr