PDB entry 1ghc

View 1ghc on RCSB PDB site
Description: homo-and heteronuclear two-dimensional nmr studies of the globular domain of histone h1: full assignment, tertiary structure, and comparison with the globular domain of histone h5
Class: chromosomal protein
Keywords: chromosomal protein
Deposited on 1994-05-16, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gh1
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ghca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ghcA (A:)
    magpsvtelitkavsaskerkglslaalkkalaaggydveknnsriklglkslvskgtlv
    qtkgtgasgsfrlsk