PDB entry 1ghb

View 1ghb on RCSB PDB site
Description: a second active site in chymotrypsin? the x-ray crystal structure of n-acetyl-d-tryptophan bound to gamma-chymotrypsin
Deposited on 1994-04-06, released 1994-06-22
The last revision prior to the SCOP 1.55 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 2 Å
R-factor: 0.152
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.55: d1ghbe_

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ghbE (E:)
    cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ghbE (E:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltrytpdrlqqaslpllsntnckkywgtkikdamicagasgv
    sscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan